PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00179.1_g00066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 189aa    MW: 21800.3 Da    PI: 10.5002
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00179.1_g00066.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.72.1e-183782299
                             H.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                       B3 22 faeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                             f +++g+ ++ + +++l +e+g++W++ ++y k sgr+ +++GWk+F+++n+ +++D ++Fkl++ +++++v++++++
  Rsa1.0_00179.1_g00066.1  3 FSRSNGLTNR-HGEIILLNEEGKQWRLLMRYHKASGRVCIRSGWKRFCNENRKRANDLLTFKLVR-NGTTPVLQLCSS 78
                             7788887765.559*************************************************98.78889**99986 PP

2B348.71.4e-1589178191
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f++ ++++++lks++l+lp kf++++g+++++  ++tl d+ g++ +  l+   k gr  l+k WkeF++ n++k+g+++ ++l++
  Rsa1.0_00179.1_g00066.1  89 FLTLTLTPYSLKSSILRLPVKFVKANGIENAR--KVTLVDRYGNKKSTSLKQYDKYGRLSLGKEWKEFCEVNEVKTGESFKLELIK 172
                              6778899*******************988555..8********999999977777789**************************98 PP

                              S.SEE. CS
                       B3  87 r.sefe 91 
                              + +e++
  Rsa1.0_00179.1_g00066.1 173 EvEEET 178
                              855554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010191.4E-14179IPR003340B3 DNA binding domain
PROSITE profilePS5086314.184178IPR003340B3 DNA binding domain
PfamPF023626.5E-17278IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-16378IPR015300DNA-binding pseudobarrel domain
CDDcd100173.75E-17376No hitNo description
SuperFamilySSF1019363.34E-17380IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-1784187IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.44E-1787175IPR015300DNA-binding pseudobarrel domain
CDDcd100178.80E-1388173No hitNo description
PROSITE profilePS5086311.85789188IPR003340B3 DNA binding domain
SMARTSM010197.9E-2089189IPR003340B3 DNA binding domain
PfamPF023622.7E-1489181IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDFSRSNGLT NRHGEIILLN EEGKQWRLLM RYHKASGRVC IRSGWKRFCN ENRKRANDLL  60
TFKLVRNGTT PVLQLCSSSS SSKTKPCRFL TLTLTPYSLK SSILRLPVKF VKANGIENAR  120
KVTLVDRYGN KKSTSLKQYD KYGRLSLGKE WKEFCEVNEV KTGESFKLEL IKEVEEETAT  180
HLLKFCSKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894311e-109AC189431.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068B07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013736128.11e-114PREDICTED: B3 domain-containing protein REM10-like
TrEMBLM4CB083e-93M4CB08_BRARP; Uncharacterized protein
STRINGBra001387.1-P8e-93(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31615.12e-38B3 family protein